(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0720

BA000012.MLR0720     Location/Qualifiers
FT   CDS             569379..569921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0720"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48255"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48255"
FT                   /db_xref="GOA:Q98M58"
FT                   /db_xref="InterPro:IPR032347"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M58"
FT                   /protein_id="BAB48255.1"
FT                   /translation="MTFRWRIFAIGETGIHRQAYVIVRLRTSFLRDHSEGQRRQAMRRA
FT                   FFAFTVIPFLFISSAFAGDAEIKAGQAVIDGQLKALLADDGAKAYSFAAPNVKQVFPTV
FT                   DAFMNMVTNGYPPVRKPQSYAFGKVEQTGPGSIIQQVLIVGPDGKDYEAVYTLQQQPDG
FT                   TLQITGCSLRASNSLST"
     MTFRWRIFAI GETGIHRQAY VIVRLRTSFL RDHSEGQRRQ AMRRAFFAFT VIPFLFISSA        60
     FAGDAEIKAG QAVIDGQLKA LLADDGAKAY SFAAPNVKQV FPTVDAFMNM VTNGYPPVRK       120
     PQSYAFGKVE QTGPGSIIQQ VLIVGPDGKD YEAVYTLQQQ PDGTLQITGC SLRASNSLST       180
//

If you have problems or comments...

PBIL Back to PBIL home page