(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0750

BA000012.MLR0750     Location/Qualifiers
FT   CDS             587958..590879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0750"
FT                   /product="excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48277"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48277"
FT                   /db_xref="GOA:Q98M36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M36"
FT                   /protein_id="BAB48277.1"
FT                   /translation="MADHKFLSIRGAREHNLKNVDLDLPRDSLIVMTGLSGSGKSSLAF
FT                   DTIYAEGQRRYVESLSAYARQFLEMMQKPDVDQIDGLSPAISIEQKTTSKNPRSTVGTV
FT                   TEIYDYMRLLFARVGVPYSPATGLPIESQTVSQMVDRVLALEEGTRLFLLAPIVRGRKG
FT                   EYRKELLELQKKGFQRVKVDGVFYEIADVPALDKKYKHDIDVVVDRIVVRGDLATRLAD
FT                   SIETALKLAEGLAVAEFADKPLDSSQTGEDSVNKSKNETHERILFSEKFACPVSGFTIP
FT                   EIEPRLFSFNNPFGACPTCDGLGSQRAIDPNLVVPDENVSLRDGAVSPWAKSTSPYYVQ
FT                   TLEALGKAYNFKLGDKFKDLSAEAQDAILRGTGEREVTFQYDDGLRSYKTTKTFEGVIP
FT                   NLERRWKETESAWMREEIERFMSATPCPVCKGYRLKPEALAVKIGGKHIGEVTEQSIRN
FT                   ADKWFTDLPAQLNDKQNEIAVRVLKEIRERLRFLNDVGLDYLTLSRNSGTLSGGESQRI
FT                   RLASQIGSGLTGVLYVLDEPSIGLHQRDNTRLLDTLKHLRDIGNTVIVVEHDEDAILHA
FT                   DYVVDMGPAAGIHGGEIIAQGTPQQVMANPNSITGKYLSGALEVATPGVRREAKKNRRL
FT                   KIVGARGNNLKNVTAEIPLGTFTAVTGVSGGGKSTFLIETLFKAASRRIMGSREHPAEH
FT                   DRIEGLEFLDKVIDIDQSPIGRTPRSNPATYTGAFTPIRDWFAGLPEAKARGYQPGRFS
FT                   FNVKGGRCEACQGDGVIKIEMHFLPDVYVTCDVCHGKRYNRETLDVLFKGKSIADVLDM
FT                   TVEEGVDFFAAVPGVRDKLDTLKQVGLGYIHIGQQATTLSGGEAQRIKLAKELSRKATG
FT                   KTLYILDEPTTGLHFHDVAKLLEVLHELVDQGNTVVVIEHNLEVIKTADWVLDLGPEGG
FT                   DGGGELVAQGTPEAIVREKRSYTGQFLKELLERRPGGKREAAE"
     MADHKFLSIR GAREHNLKNV DLDLPRDSLI VMTGLSGSGK SSLAFDTIYA EGQRRYVESL        60
     SAYARQFLEM MQKPDVDQID GLSPAISIEQ KTTSKNPRST VGTVTEIYDY MRLLFARVGV       120
     PYSPATGLPI ESQTVSQMVD RVLALEEGTR LFLLAPIVRG RKGEYRKELL ELQKKGFQRV       180
     KVDGVFYEIA DVPALDKKYK HDIDVVVDRI VVRGDLATRL ADSIETALKL AEGLAVAEFA       240
     DKPLDSSQTG EDSVNKSKNE THERILFSEK FACPVSGFTI PEIEPRLFSF NNPFGACPTC       300
     DGLGSQRAID PNLVVPDENV SLRDGAVSPW AKSTSPYYVQ TLEALGKAYN FKLGDKFKDL       360
     SAEAQDAILR GTGEREVTFQ YDDGLRSYKT TKTFEGVIPN LERRWKETES AWMREEIERF       420
     MSATPCPVCK GYRLKPEALA VKIGGKHIGE VTEQSIRNAD KWFTDLPAQL NDKQNEIAVR       480
     VLKEIRERLR FLNDVGLDYL TLSRNSGTLS GGESQRIRLA SQIGSGLTGV LYVLDEPSIG       540
     LHQRDNTRLL DTLKHLRDIG NTVIVVEHDE DAILHADYVV DMGPAAGIHG GEIIAQGTPQ       600
     QVMANPNSIT GKYLSGALEV ATPGVRREAK KNRRLKIVGA RGNNLKNVTA EIPLGTFTAV       660
     TGVSGGGKST FLIETLFKAA SRRIMGSREH PAEHDRIEGL EFLDKVIDID QSPIGRTPRS       720
     NPATYTGAFT PIRDWFAGLP EAKARGYQPG RFSFNVKGGR CEACQGDGVI KIEMHFLPDV       780
     YVTCDVCHGK RYNRETLDVL FKGKSIADVL DMTVEEGVDF FAAVPGVRDK LDTLKQVGLG       840
     YIHIGQQATT LSGGEAQRIK LAKELSRKAT GKTLYILDEP TTGLHFHDVA KLLEVLHELV       900
     DQGNTVVVIE HNLEVIKTAD WVLDLGPEGG DGGGELVAQG TPEAIVREKR SYTGQFLKEL       960
     LERRPGGKRE AAE                                                          973
//

If you have problems or comments...

PBIL Back to PBIL home page