(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0752

BA000012.MLR0752     Location/Qualifiers
FT   CDS             591443..592249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0752"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48279"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48279"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M34"
FT                   /protein_id="BAB48279.1"
FT                   /translation="MSKSGTIRSGMGGWTFEPWDTSFYPDKLSKAKQLQYASRQVPSIE
FT                   VNGTYYSSFKEPTFVKWASEAPDGFVYSLKGNRFVTNRRVLGEAGESMMRFLGSGVAAL
FT                   GDKLGPILWQFAPTKKFDPDDFEAFLKLLPEKQDGVALRHALEVRNDSFFVPEFAALAR
FT                   KYKAAIVYADHAKYPDIADVTGDFVYARLQTGSDDNPDCYTPKGLDEWAARAKIWAEGK
FT                   QPADLRRADPATDAPVQPRDVFVYFITEGKVRAPFGAMALMKRIAG"
     MSKSGTIRSG MGGWTFEPWD TSFYPDKLSK AKQLQYASRQ VPSIEVNGTY YSSFKEPTFV        60
     KWASEAPDGF VYSLKGNRFV TNRRVLGEAG ESMMRFLGSG VAALGDKLGP ILWQFAPTKK       120
     FDPDDFEAFL KLLPEKQDGV ALRHALEVRN DSFFVPEFAA LARKYKAAIV YADHAKYPDI       180
     ADVTGDFVYA RLQTGSDDNP DCYTPKGLDE WAARAKIWAE GKQPADLRRA DPATDAPVQP       240
     RDVFVYFITE GKVRAPFGAM ALMKRIAG                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page