(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0763

BA000012.MLR0763     Location/Qualifiers
FT   CDS             600188..600595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0763"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48287"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48287"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M26"
FT                   /protein_id="BAB48287.1"
FT                   /translation="MASLISRILIGTVLLAAATGAAHADFSDGKMPDGTYHCEVYLLGM
FT                   FLDLGDITIKGNVYTGPVTFGTAQQAYNYQMNANGEISWLGPLGGYTAGGNSLSMTQAT
FT                   LDGQNPPSFDIIMKQPDGAFTASTCTLGSNP"
     MASLISRILI GTVLLAAATG AAHADFSDGK MPDGTYHCEV YLLGMFLDLG DITIKGNVYT        60
     GPVTFGTAQQ AYNYQMNANG EISWLGPLGG YTAGGNSLSM TQATLDGQNP PSFDIIMKQP       120
     DGAFTASTCT LGSNP                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page