(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0776

BA000012.MLR0776     Location/Qualifiers
FT   CDS             610039..611124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0776"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48295"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48295"
FT                   /db_xref="GOA:Q98M18"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M18"
FT                   /protein_id="BAB48295.1"
FT                   /translation="MTAPRKPAAFRIEPEAAPTQETPKARQAELSRKPRGLKTDVALVI
FT                   PAEVDVFDEPDIVAAEPPPAAAPRKRSLFGSIFFGAIGVLVSLAVGLWTDQLIRDLFAR
FT                   AEWLGWLAAGMAAIAVLALVVILIREFLAIARLAEVEKLQKRALDAIARDDPKAARSVV
FT                   DELSAFVAAKPETAAGRRALAELRGEIIDGGNLVRLAEAEILGPLDARAKVMILEAAKR
FT                   VSLVTAVSPRALVDVAYVVFEAGRLIRRLSELYGGRPGTLGFFRLARSVLAHLAVTGSI
FT                   AVGDSFVQQIVGHGLAARLSAKLGEGVVNGMMTARIGIAAMETARPLPFSAAKRPGLGD
FT                   FLSALTSFAAKKDTETTGSGK"
     MTAPRKPAAF RIEPEAAPTQ ETPKARQAEL SRKPRGLKTD VALVIPAEVD VFDEPDIVAA        60
     EPPPAAAPRK RSLFGSIFFG AIGVLVSLAV GLWTDQLIRD LFARAEWLGW LAAGMAAIAV       120
     LALVVILIRE FLAIARLAEV EKLQKRALDA IARDDPKAAR SVVDELSAFV AAKPETAAGR       180
     RALAELRGEI IDGGNLVRLA EAEILGPLDA RAKVMILEAA KRVSLVTAVS PRALVDVAYV       240
     VFEAGRLIRR LSELYGGRPG TLGFFRLARS VLAHLAVTGS IAVGDSFVQQ IVGHGLAARL       300
     SAKLGEGVVN GMMTARIGIA AMETARPLPF SAAKRPGLGD FLSALTSFAA KKDTETTGSG       360
     K                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page