(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0794

BA000012.MLR0794     Location/Qualifiers
FT   CDS             622716..623192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0794"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48309"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48309"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M04"
FT                   /protein_id="BAB48309.1"
FT                   /translation="MPSWAMKVSLVICHLKGVSAEIITPADKSTAARKRRSVTFFQKTG
FT                   SAIDGGDEIAHFVDQFAEPIEGLAVFRLPLDLGGTIGDGKGADAASGPLQPMRQQKPVL
FT                   EIGIDYFVAYRQRLLYKQRQHLLLEGAVAHRLPGKVCQIDRSGLPGSRDVASGH"
     MPSWAMKVSL VICHLKGVSA EIITPADKST AARKRRSVTF FQKTGSAIDG GDEIAHFVDQ        60
     FAEPIEGLAV FRLPLDLGGT IGDGKGADAA SGPLQPMRQQ KPVLEIGIDY FVAYRQRLLY       120
     KQRQHLLLEG AVAHRLPGKV CQIDRSGLPG SRDVASGH                               158
//

If you have problems or comments...

PBIL Back to PBIL home page