(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0812

BA000012.MLR0812     Location/Qualifiers
FT   CDS             641929..643131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0812"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48321"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48321"
FT                   /db_xref="InterPro:IPR021293"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LZ2"
FT                   /protein_id="BAB48321.1"
FT                   /translation="MTSGGLKRAHAAMLLGLLLSGATITEPQAASRVCRQLEADLAAAS
FT                   RGGGGGPAMIRKYDAAIDRQREQISKARDQADSAGCGFSLFSRNINRCAGLNATIDRMN
FT                   ANLDSLQAKRAQLAGGGGSRRDRGRILAALDANGCRDDTVAPRRAPLQEADRGEQDGKA
FT                   DLFDQLFGNQQSDTLDQPDDPSEERNVRGVLNLPGIPDVPGTGGEFHTTCVRTCDGYFF
FT                   PMSNAASVGDFERDQKNCESSCPGTEMQVFYSRGMDDDSASMTSSVTGRPYSELPTAYL
FT                   YKQSNMSRPPACGCNAAQNFQIIGGNPPPPQQSLPETEAAPLVPVPASKPDPGADPETL
FT                   ANREGGLDREAVKRLSAKPVTSPVSALPPEQRKVRVVGPTFLPDPSAAINLQAPAPKAV
FT                   Q"
     MTSGGLKRAH AAMLLGLLLS GATITEPQAA SRVCRQLEAD LAAASRGGGG GPAMIRKYDA        60
     AIDRQREQIS KARDQADSAG CGFSLFSRNI NRCAGLNATI DRMNANLDSL QAKRAQLAGG       120
     GGSRRDRGRI LAALDANGCR DDTVAPRRAP LQEADRGEQD GKADLFDQLF GNQQSDTLDQ       180
     PDDPSEERNV RGVLNLPGIP DVPGTGGEFH TTCVRTCDGY FFPMSNAASV GDFERDQKNC       240
     ESSCPGTEMQ VFYSRGMDDD SASMTSSVTG RPYSELPTAY LYKQSNMSRP PACGCNAAQN       300
     FQIIGGNPPP PQQSLPETEA APLVPVPASK PDPGADPETL ANREGGLDRE AVKRLSAKPV       360
     TSPVSALPPE QRKVRVVGPT FLPDPSAAIN LQAPAPKAVQ                             400
//

If you have problems or comments...

PBIL Back to PBIL home page