(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0843

BA000012.MLR0843     Location/Qualifiers
FT   CDS             674348..675079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0843"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48346"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48346"
FT                   /db_xref="GOA:Q98LW7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW7"
FT                   /protein_id="BAB48346.1"
FT                   /translation="MTKADVDKLDKGLAAHGGRPLRPRDAATLILLDRKGDEVLVLMGR
FT                   RHAGHAFMPGKFVFPGGRTDPADSRIATATALHRDEEAKLLAGPGRTSAARARAVALSA
FT                   IRETYEEAGLLIGERAAFATDKRDWQGFVEHGVRPSLETLRFIARAITPPNRVRRFDTR
FT                   FFSAWRSDVAVELPGGGPTNELEELVWLPLAKAREADIPDITRMILDELEKRLAHDPLL
FT                   RPGGPVPFYRLVRNRFTRELL"
     MTKADVDKLD KGLAAHGGRP LRPRDAATLI LLDRKGDEVL VLMGRRHAGH AFMPGKFVFP        60
     GGRTDPADSR IATATALHRD EEAKLLAGPG RTSAARARAV ALSAIRETYE EAGLLIGERA       120
     AFATDKRDWQ GFVEHGVRPS LETLRFIARA ITPPNRVRRF DTRFFSAWRS DVAVELPGGG       180
     PTNELEELVW LPLAKAREAD IPDITRMILD ELEKRLAHDP LLRPGGPVPF YRLVRNRFTR       240
     ELL                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page