(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0868

BA000012.MLR0868     Location/Qualifiers
FT   CDS             693663..694544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0868"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48364"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48364"
FT                   /db_xref="GOA:Q98LU9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU9"
FT                   /protein_id="BAB48364.1"
FT                   /translation="MAPTPSIPKAAFWMALSISSFLAMSVAGRATTAELNVFQVLELRS
FT                   VIGFFILLPLVLTSGGFAAMRTQRPLAHIARNVVHYSGQAAWLYALTLIPLAVLISIEF
FT                   TTPIWTAILAVTFLGERLSRPKLAAVGLGLIGVVVIVRPGVDAVDPGHLVVLGAAVCFG
FT                   ISLVLVKSLTRTDSVVRIIFWMLIIQSALGLVPALYVWRTPSLELWPWILLIAFTGMSS
FT                   HFCMARALTYADATVISPMDFLRVPLSALVGWLLYHEQIDAFTAGGALLILMGNLLNLQ
FT                   RKPVQPAEVAAS"
     MAPTPSIPKA AFWMALSISS FLAMSVAGRA TTAELNVFQV LELRSVIGFF ILLPLVLTSG        60
     GFAAMRTQRP LAHIARNVVH YSGQAAWLYA LTLIPLAVLI SIEFTTPIWT AILAVTFLGE       120
     RLSRPKLAAV GLGLIGVVVI VRPGVDAVDP GHLVVLGAAV CFGISLVLVK SLTRTDSVVR       180
     IIFWMLIIQS ALGLVPALYV WRTPSLELWP WILLIAFTGM SSHFCMARAL TYADATVISP       240
     MDFLRVPLSA LVGWLLYHEQ IDAFTAGGAL LILMGNLLNL QRKPVQPAEV AAS              293
//

If you have problems or comments...

PBIL Back to PBIL home page