(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0874

BA000012.MLR0874     Location/Qualifiers
FT   CDS             702658..703332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0874"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48369"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48369"
FT                   /db_xref="GOA:Q98LU4"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR014185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LU4"
FT                   /protein_id="BAB48369.1"
FT                   /translation="MRASRSVASWFTEASHTPPTDRPATSVVQNWEEKRMAEKLHPRID
FT                   NGLPKESASFAGGTLVCACTSKPVKVKVKGQIAHNHACGCTKCWKPEGAIFSVVAVAGT
FT                   GDVTVTENGDKLKVVDASALIQRHACTGCGVHMHGPVERDHAFKGLTFIHPERFVEDGW
FT                   SPPGFTAFVSSIIESGVDPKRMDGIRAQLRTIGLEPYDCLNPGLMDYIATWTAKKSGAL
FT                   PA"
     MRASRSVASW FTEASHTPPT DRPATSVVQN WEEKRMAEKL HPRIDNGLPK ESASFAGGTL        60
     VCACTSKPVK VKVKGQIAHN HACGCTKCWK PEGAIFSVVA VAGTGDVTVT ENGDKLKVVD       120
     ASALIQRHAC TGCGVHMHGP VERDHAFKGL TFIHPERFVE DGWSPPGFTA FVSSIIESGV       180
     DPKRMDGIRA QLRTIGLEPY DCLNPGLMDY IATWTAKKSG ALPA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page