(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0877

BA000012.MLR0877     Location/Qualifiers
FT   CDS             704670..705551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0877"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48372"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48372"
FT                   /db_xref="GOA:Q98LU1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU1"
FT                   /protein_id="BAB48372.1"
FT                   /translation="MQSVARSQSATGPDAPVSSDSTLIYRQSRWTRLTHWIWAISLFFM
FT                   LLSGLQIFNARPQLYIGKQSGFGYNNTIFEIGAVNTDAGPRGFTEIFGHRFDTTGVLGW
FT                   SGPPGNETARGFPSWATIPSYYDLGTARVVHFFFAWILTTTLIVWLVASLVNGHIRRDL
FT                   APRLDDLKRLPRDIVDHARLKFHHTREYNTLQKMAYGGVLFVLLPLMIITGLAMSPSMN
FT                   SVLPFLNEVLGGRQTARTIHFTVMLLLVGFFIIHILMILAAGPINELRSIITGWYRTDP
FT                   PAHDDKTTERSA"
     MQSVARSQSA TGPDAPVSSD STLIYRQSRW TRLTHWIWAI SLFFMLLSGL QIFNARPQLY        60
     IGKQSGFGYN NTIFEIGAVN TDAGPRGFTE IFGHRFDTTG VLGWSGPPGN ETARGFPSWA       120
     TIPSYYDLGT ARVVHFFFAW ILTTTLIVWL VASLVNGHIR RDLAPRLDDL KRLPRDIVDH       180
     ARLKFHHTRE YNTLQKMAYG GVLFVLLPLM IITGLAMSPS MNSVLPFLNE VLGGRQTART       240
     IHFTVMLLLV GFFIIHILMI LAAGPINELR SIITGWYRTD PPAHDDKTTE RSA              293
//

If you have problems or comments...

PBIL Back to PBIL home page