(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0879

BA000012.MLR0879     Location/Qualifiers
FT   CDS             705520..706362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0879"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48373"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48373"
FT                   /db_xref="GOA:Q98LU0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LU0"
FT                   /protein_id="BAB48373.1"
FT                   /translation="MTTRRPRGVPDMAKFEISPNFQISRRKFLTAASLGASGIMLSGCD
FT                   AFDSQLSIGSGLRSFLENANGLTYRAQRLLAGRDALAPEFTEADIRQPQRPNGVTAPDD
FT                   DTYKGLLANNFADWRLEVSGLVEKPLSLSREQLQNMPSRTQITRHDCVEGWSCIAKWTG
FT                   TPLSLVLDQAVVKPQARYVMFHCLDTIDRSLSGDIKYYGTIDLIDARHPQTILAYGLNG
FT                   KPLPVENGAPLRVRVERQLGYKMPKYLYKIELVDGFANVGGGRGGYWEDNGYDWYGGI"
     MTTRRPRGVP DMAKFEISPN FQISRRKFLT AASLGASGIM LSGCDAFDSQ LSIGSGLRSF        60
     LENANGLTYR AQRLLAGRDA LAPEFTEADI RQPQRPNGVT APDDDTYKGL LANNFADWRL       120
     EVSGLVEKPL SLSREQLQNM PSRTQITRHD CVEGWSCIAK WTGTPLSLVL DQAVVKPQAR       180
     YVMFHCLDTI DRSLSGDIKY YGTIDLIDAR HPQTILAYGL NGKPLPVENG APLRVRVERQ       240
     LGYKMPKYLY KIELVDGFAN VGGGRGGYWE DNGYDWYGGI                             280
//

If you have problems or comments...

PBIL Back to PBIL home page