(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0925

BA000012.MLR0925     Location/Qualifiers
FT   CDS             746079..747053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0925"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48409"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48409"
FT                   /db_xref="GOA:Q98LQ4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ4"
FT                   /protein_id="BAB48409.1"
FT                   /translation="MMLEWASLRNRPDVREANGLTSSGGTSETKSPKKTGISLALGGGC
FT                   ARGWAHIGVLRALDEAGIEVSMIAGTSIGALVGGCYLAGKLDELEEFARSLTKRRIFGL
FT                   LDLNLRGSGLFGGMKLDARLREHVAGVRFEDLPKPFVSVASEIRTGHEIWLSNGSLITA
FT                   MRASYALPGVFEPVNCNGRMLVDGALVNPVPVSVCRAYEQPLVVAVNLHYDLFGRAAVI
FT                   KHSAGELVVEKDAPRPGHVGAEYQSHQTRLGITGVMVEAFNIIQDRISRARLAGDPPDM
FT                   SLQPKLSHIGLTEFHRADEAIQIGYQATTAQIGELTRLQTVLA"
     MMLEWASLRN RPDVREANGL TSSGGTSETK SPKKTGISLA LGGGCARGWA HIGVLRALDE        60
     AGIEVSMIAG TSIGALVGGC YLAGKLDELE EFARSLTKRR IFGLLDLNLR GSGLFGGMKL       120
     DARLREHVAG VRFEDLPKPF VSVASEIRTG HEIWLSNGSL ITAMRASYAL PGVFEPVNCN       180
     GRMLVDGALV NPVPVSVCRA YEQPLVVAVN LHYDLFGRAA VIKHSAGELV VEKDAPRPGH       240
     VGAEYQSHQT RLGITGVMVE AFNIIQDRIS RARLAGDPPD MSLQPKLSHI GLTEFHRADE       300
     AIQIGYQATT AQIGELTRLQ TVLA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page