(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0926

BA000012.MLR0926     Location/Qualifiers
FT   CDS             747214..747780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0926"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48410"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48410"
FT                   /db_xref="GOA:Q98LQ3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ3"
FT                   /protein_id="BAB48410.1"
FT                   /translation="MAKIVYSMLTSLDGYIAGPDGDIGLPVPETELHQHFNDMMRQASA
FT                   VLAGRRMYETMRFWDSPDRETGATEVERDFADAWRDTPKIVFSTTLRQVGSNARLVNGD
FT                   AETAVRSLKTKTDGLVILGGADLAADLTRAGLIDEYRLYMHPVVLGGGKPYFQSGLSLA
FT                   LKPLGTESLPQGVTLLRYAPANQAA"
     MAKIVYSMLT SLDGYIAGPD GDIGLPVPET ELHQHFNDMM RQASAVLAGR RMYETMRFWD        60
     SPDRETGATE VERDFADAWR DTPKIVFSTT LRQVGSNARL VNGDAETAVR SLKTKTDGLV       120
     ILGGADLAAD LTRAGLIDEY RLYMHPVVLG GGKPYFQSGL SLALKPLGTE SLPQGVTLLR       180
     YAPANQAA                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page