(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0956

BA000012.MLR0956     Location/Qualifiers
FT   CDS             778023..778562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0956"
FT                   /product="DNA repair protein; RadC"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48431"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48431"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN2"
FT                   /protein_id="BAB48431.1"
FT                   /translation="MRERFASAGADALPDYELLELLLFRLIPRADTKPAAKALLARFGT
FT                   LAEVLGAPVNLLQEVKGIGPAVALDLKVVAATAQRMAHGEVHGREVLSSWTQLLAYCRS
FT                   AMAFEAREQFRILFLDKKNALIADEVQQTGTVDHTPVYPREVVKRALELSATAIILVHN
FT                   HPTRLFLITHNHALAH"
     MRERFASAGA DALPDYELLE LLLFRLIPRA DTKPAAKALL ARFGTLAEVL GAPVNLLQEV        60
     KGIGPAVALD LKVVAATAQR MAHGEVHGRE VLSSWTQLLA YCRSAMAFEA REQFRILFLD       120
     KKNALIADEV QQTGTVDHTP VYPREVVKRA LELSATAIIL VHNHPTRLFL ITHNHALAH        179
//

If you have problems or comments...

PBIL Back to PBIL home page