(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0970

BA000012.MLR0970     Location/Qualifiers
FT   CDS             793208..793738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0970"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48442"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48442"
FT                   /db_xref="GOA:Q98LM1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM1"
FT                   /protein_id="BAB48442.1"
FT                   /translation="MQSPRRLLFGNVGAAIMADILQRESGSAEHAVATEELTSVEVDVS
FT                   ALAPGTSVVVNWNGKPVVVRHRTEKERKDSEAVNLADLKDPIARNANLPADAPATDANR
FT                   AAPGKEAWIVIVQVCTHLGCIPSYKEGDFGGWLCPCHGSQYDSAGRVRKGPALENMAVP
FT                   EFQFISDTKIRIG"
     MQSPRRLLFG NVGAAIMADI LQRESGSAEH AVATEELTSV EVDVSALAPG TSVVVNWNGK        60
     PVVVRHRTEK ERKDSEAVNL ADLKDPIARN ANLPADAPAT DANRAAPGKE AWIVIVQVCT       120
     HLGCIPSYKE GDFGGWLCPC HGSQYDSAGR VRKGPALENM AVPEFQFISD TKIRIG           176
//

If you have problems or comments...

PBIL Back to PBIL home page