(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0971

BA000012.MLR0971     Location/Qualifiers
FT   CDS             793755..795035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0971"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48443"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48443"
FT                   /db_xref="GOA:Q98LM0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM0"
FT                   /protein_id="BAB48443.1"
FT                   /translation="MREGHSTYKPKTGIERWLDGRLPLPRVVHDSFIVYPVPRNLNFAY
FT                   TFGGILTMMLGLQVATGIVLAMHYAADTTLAFNTVEKIVRDVNSGWLLRSLHANGASFF
FT                   FIAVYVHIFRGLYYGSYKAPRELLWILGCLNVLLMMAIAFIGYVLPWGQMSFWGATVIT
FT                   NFFTAIPLVGGWIQKLLLGGFAVENPTLNRFFALHYLLPFLLIGNVTLHIWALHVVGQN
FT                   NPAGIDVQSSTDVVDFTPHATIKDIFGAVMFLIVFLYFVFYLPNYLGHPDNYSAADPLK
FT                   TPSHIVPEWYFLPFYAMLRAVNFNVGPIDSKLGGVLALFGAIVVLFFVPWLDRTSVRSA
FT                   VYRPLYRRFFWLFASDVIFLGWLGSKPAEGWYVPAMQAATLFYFAFFIIVVPLIGMIEK
FT                   PLRLPNSITEVVLERNKKRRPKDRTAS"
     MREGHSTYKP KTGIERWLDG RLPLPRVVHD SFIVYPVPRN LNFAYTFGGI LTMMLGLQVA        60
     TGIVLAMHYA ADTTLAFNTV EKIVRDVNSG WLLRSLHANG ASFFFIAVYV HIFRGLYYGS       120
     YKAPRELLWI LGCLNVLLMM AIAFIGYVLP WGQMSFWGAT VITNFFTAIP LVGGWIQKLL       180
     LGGFAVENPT LNRFFALHYL LPFLLIGNVT LHIWALHVVG QNNPAGIDVQ SSTDVVDFTP       240
     HATIKDIFGA VMFLIVFLYF VFYLPNYLGH PDNYSAADPL KTPSHIVPEW YFLPFYAMLR       300
     AVNFNVGPID SKLGGVLALF GAIVVLFFVP WLDRTSVRSA VYRPLYRRFF WLFASDVIFL       360
     GWLGSKPAEG WYVPAMQAAT LFYFAFFIIV VPLIGMIEKP LRLPNSITEV VLERNKKRRP       420
     KDRTAS                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page