(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0055

BA000012.MSL0055     Location/Qualifiers
FT   CDS             complement(41212..41445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0055"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47722"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47722"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NN9"
FT                   /protein_id="BAB47722.1"
FT                   /translation="MAMDAHDIEKLIKDGIPDAKVTIRDLAGDGDHYAAEVVAESFRGK
FT                   SRVQQHQMVYDALKGNMGGVLHALALQTSVPD"
     MAMDAHDIEK LIKDGIPDAK VTIRDLAGDG DHYAAEVVAE SFRGKSRVQQ HQMVYDALKG        60
     NMGGVLHALA LQTSVPD                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page