(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0146

BA000012.MSL0146     Location/Qualifiers
FT   CDS             complement(103311..103550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0146"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47793"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47793"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG8"
FT                   /protein_id="BAB47793.1"
FT                   /translation="MAKLTYKIVEHDGGWAYKVGSTFSETFPTHQDALRAAEIASAEQQ
FT                   VAGATDGIQYEDADGKWHEELADGRDRPQTEVSE"
     MAKLTYKIVE HDGGWAYKVG STFSETFPTH QDALRAAEIA SAEQQVAGAT DGIQYEDADG        60
     KWHEELADGR DRPQTEVSE                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page