(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0438

BA000012.MSL0438     Location/Qualifiers
FT   CDS             complement(317539..317748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0438"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48021"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48021"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU2"
FT                   /protein_id="BAB48021.1"
FT                   /translation="MGKVLNLPALLLLAACVTTAPVNNPRKIWCDHNQPRRPSLVVINV
FT                   MTRAELDEMNTFNAQGAKWCGWKP"
     MGKVLNLPAL LLLAACVTTA PVNNPRKIWC DHNQPRRPSL VVINVMTRAE LDEMNTFNAQ        60
     GAKWCGWKP                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page