(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0439

BA000012.MSL0439     Location/Qualifiers
FT   CDS             complement(317733..318029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0439"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48022"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48022"
FT                   /db_xref="GOA:Q98MU1"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MU1"
FT                   /protein_id="BAB48022.1"
FT                   /translation="MIPTSARRREMGALIVSILGALVGNKVIMTLFAAVVGGLYVAGGI
FT                   NRAKKDKAATAARDLAAAQDQLEMDREATAAEKQAAGMTNAQAKAEATKWAKS"
     MIPTSARRRE MGALIVSILG ALVGNKVIMT LFAAVVGGLY VAGGINRAKK DKAATAARDL        60
     AAAQDQLEMD REATAAEKQA AGMTNAQAKA EATKWAKS                                98
//

If you have problems or comments...

PBIL Back to PBIL home page