(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0491

BA000012.MSL0491     Location/Qualifiers
FT   CDS             complement(362562..362795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0491"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48068"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48068"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP5"
FT                   /protein_id="BAB48068.1"
FT                   /translation="MDASEMSAIGDTLMRIVTPDMSPKQLVKAAQKAHPKASKKDIARA
FT                   AFFSIIANADQDIGKAKNLQAFAIAERTQPSD"
     MDASEMSAIG DTLMRIVTPD MSPKQLVKAA QKAHPKASKK DIARAAFFSI IANADQDIGK        60
     AKNLQAFAIA ERTQPSD                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page