(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0637

BA000012.MSL0637     Location/Qualifiers
FT   CDS             complement(505230..505322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0637"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48191"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48191"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC2"
FT                   /protein_id="BAB48191.1"
FT                   /translation="MKKFGFGMVDVETPFTMHGDMSDAKATHQG"
     MKKFGFGMVD VETPFTMHGD MSDAKATHQG                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page