(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL0722

BA000012.MSL0722     Location/Qualifiers
FT   CDS             complement(571049..571318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl0722"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48257"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48257"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M56"
FT                   /protein_id="BAB48257.1"
FT                   /translation="MDDDLQTLDRDALIAEVKKLRAGIRAHRDTSGHDLCWHHPDLWDL
FT                   LPEKTEPSIAVPPWPKFMRGCIQYRQSLDRQAPDAPIHDKEFNG"
     MDDDLQTLDR DALIAEVKKL RAGIRAHRDT SGHDLCWHHP DLWDLLPEKT EPSIAVPPWP        60
     KFMRGCIQYR QSLDRQAPDA PIHDKEFNG                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page