(data stored in ACNUC7421 zone)

EMBL: BA000012.MSL8587

BA000012.MSL8587     Location/Qualifiers
FT   CDS             complement(347894..348763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msl8587"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48055"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48055"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ8"
FT                   /protein_id="BAB48055.1"
FT                   /translation="MYDQTQTTGITALPYTVVRIRAGDVANPQAVHKGTGFFYHFREGA
FT                   GNVPLIVSNKHVLVGKEWLEFDFALLDNQGKRVFGPANTFRLTKNQLPIFEHPDPTVDL
FT                   AAIPIQPIVEAMRGQGKEIFNLLLGRETIAPDNIQAILHAATSVLMVGFPSGIMDEKNN
FT                   LPVVRRGILAVNYLTDYRGETNFVVDIAAFGGSSGSPVFAFFENMLPDGSGGVTMLAQP
FT                   QVYFLGVLHSGPSMTATGKIVPVPVPTSDQIAQTQMMLHLGYCVKASRVEELVETIRAK
FT                   ISEPTASG"
     MYDQTQTTGI TALPYTVVRI RAGDVANPQA VHKGTGFFYH FREGAGNVPL IVSNKHVLVG        60
     KEWLEFDFAL LDNQGKRVFG PANTFRLTKN QLPIFEHPDP TVDLAAIPIQ PIVEAMRGQG       120
     KEIFNLLLGR ETIAPDNIQA ILHAATSVLM VGFPSGIMDE KNNLPVVRRG ILAVNYLTDY       180
     RGETNFVVDI AAFGGSSGSP VFAFFENMLP DGSGGVTMLA QPQVYFLGVL HSGPSMTATG       240
     KIVPVPVPTS DQIAQTQMML HLGYCVKASR VEELVETIRA KISEPTASG                   289
//

If you have problems or comments...

PBIL Back to PBIL home page