(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0098

BA000012.MSR0098     Location/Qualifiers
FT   CDS             68666..68758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0098"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47754"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47754"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NK7"
FT                   /protein_id="BAB47754.1"
FT                   /translation="MFLRARPGEHFREETHESGSWLVLHASQYR"
     MFLRARPGEH FREETHESGS WLVLHASQYR                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page