(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0259

BA000012.MSR0259     Location/Qualifiers
FT   CDS             183249..183506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0259"
FT                   /product="transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47883"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47883"
FT                   /db_xref="GOA:Q98N78"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N78"
FT                   /protein_id="BAB47883.1"
FT                   /translation="MGIISWIILGAIAGFLGSKIVNKTGQGLIMDIVLGIVGAIVGGVI
FT                   CSRLFGVGVTGLNISSLIVAVVGAIVVLWAYHQFSGRRTL"
     MGIISWIILG AIAGFLGSKI VNKTGQGLIM DIVLGIVGAI VGGVICSRLF GVGVTGLNIS        60
     SLIVAVVGAI VVLWAYHQFS GRRTL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page