(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0297

BA000012.MSR0297     Location/Qualifiers
FT   CDS             212079..212357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0297"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47910"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47910"
FT                   /db_xref="GOA:Q98N53"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N53"
FT                   /protein_id="BAB47910.1"
FT                   /translation="MTRSIWKGPFIDGYLLKKVDKVREGGRNEVIKMWSRRSTILPQFV
FT                   GFTFGVYNGQKHVPVSVNEDMVGHKFGEFAPTRTYYGHGADKKAKRK"
     MTRSIWKGPF IDGYLLKKVD KVREGGRNEV IKMWSRRSTI LPQFVGFTFG VYNGQKHVPV        60
     SVNEDMVGHK FGEFAPTRTY YGHGADKKAK RK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page