(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0303

BA000012.MSR0303     Location/Qualifiers
FT   CDS             213929..214129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0303"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47914"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47914"
FT                   /db_xref="GOA:Q98N49"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98N49"
FT                   /protein_id="BAB47914.1"
FT                   /translation="MKAEDIRTKTQDQLTDDLASLKKEQFNLRFQKATGQLEKTARVRQ
FT                   VRKDIARIKTIAAEKSAAKKA"
     MKAEDIRTKT QDQLTDDLAS LKKEQFNLRF QKATGQLEKT ARVRQVRKDI ARIKTIAAEK        60
     SAAKKA                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page