(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0389

BA000012.MSR0389     Location/Qualifiers
FT   CDS             277215..277472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0389"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47980"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47980"
FT                   /db_xref="GOA:Q98MY3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MY3"
FT                   /protein_id="BAB47980.1"
FT                   /translation="MHLNGVGWIAAIIIGGLAGWFAEMVMKSNTGIFMNIIMGIVGAVV
FT                   LNAILQALNFGPFGVGWIAYLITGFIGACLLIWVGRLVRR"
     MHLNGVGWIA AIIIGGLAGW FAEMVMKSNT GIFMNIIMGI VGAVVLNAIL QALNFGPFGV        60
     GWIAYLITGF IGACLLIWVG RLVRR                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page