(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0471

BA000012.MSR0471     Location/Qualifiers
FT   CDS             343822..343983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0471"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48050"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48050"
FT                   /db_xref="GOA:Q98MR3"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR3"
FT                   /protein_id="BAB48050.1"
FT                   /translation="MQWKRNDRCRFVSVLFHLARNSHMAECFVTVALFGAVVGVYRAIS
FT                   ALEGRKAL"
     MQWKRNDRCR FVSVLFHLAR NSHMAECFVT VALFGAVVGV YRAISALEGR KAL               53
//

If you have problems or comments...

PBIL Back to PBIL home page