(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0584

BA000012.MSR0584     Location/Qualifiers
FT   CDS             433823..433996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0584"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48144"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48144"
FT                   /db_xref="GOA:Q98MG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG9"
FT                   /protein_id="BAB48144.1"
FT                   /translation="MVTPSHFSGGLQGPWEAIAGMVRSNLFKRRNLAAICALSAFPPFI
FT                   NFQLINYKFLKF"
     MVTPSHFSGG LQGPWEAIAG MVRSNLFKRR NLAAICALSA FPPFINFQLI NYKFLKF           57
//

If you have problems or comments...

PBIL Back to PBIL home page