(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0611

BA000012.MSR0611     Location/Qualifiers
FT   CDS             477338..477508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0611"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48167"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48167"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ME6"
FT                   /protein_id="BAB48167.1"
FT                   /translation="MNPLPIILSSFSEALVPFIFQLPATSGRIPGVMVCFSGRYQALAL
FT                   TTKIRPQSNRQ"
     MNPLPIILSS FSEALVPFIF QLPATSGRIP GVMVCFSGRY QALALTTKIR PQSNRQ            56
//

If you have problems or comments...

PBIL Back to PBIL home page