(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR0965

BA000012.MSR0965     Location/Qualifiers
FT   CDS             789197..789415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr0965"
FT                   /product="probable conjugal transfer protein; TraD"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48438"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48438"
FT                   /db_xref="GOA:Q98LM5"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM5"
FT                   /protein_id="BAB48438.1"
FT                   /translation="MRTWQVERRKRTRHLIELGGLVVKAGIVELTSDDRAIIYGAMLWI
FT                   AAKMQSHESEHARELWAAKGKQAFDAK"
     MRTWQVERRK RTRHLIELGG LVVKAGIVEL TSDDRAIIYG AMLWIAAKMQ SHESEHAREL        60
     WAAKGKQAFD AK                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page