(data stored in ACNUC7421 zone)

EMBL: BA000012.MSR8578

BA000012.MSR8578     Location/Qualifiers
FT   CDS             91615..91809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msr8578"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47783"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47783"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NH8"
FT                   /protein_id="BAB47783.1"
FT                   /translation="MIVRKLACVFLGRPDPAGERQGMPAEPRHLPRAALGSTEWADFAN
FT                   ANPDGSAWDAFTLTRCSDD"
     MIVRKLACVF LGRPDPAGER QGMPAEPRHL PRAALGSTEW ADFANANPDG SAWDAFTLTR        60
     CSDD                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page