(data stored in ACNUC7421 zone)

EMBL: BA000030.FECB

BA000030.FECB        Location/Qualifiers
FT   CDS             complement(753242..754285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecB"
FT                   /locus_tag="SAVERM_602"
FT                   /old_locus_tag="SAV_602"
FT                   /product="putative ABC transporter
FT                   iron(III)/siderophore-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_602"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68312"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q79ZS2"
FT                   /protein_id="BAC68312.1"
FT                   /translation="MSKKRPVAVALAGALCLVTAACADSSTDQDGATGDKASAAAAKSG
FT                   YPAILENCGVSEKFTKAPGRVVVMNGASVAEVSTLLSLGLGDRVVANQQSYGMSEVPGR
FT                   AKAIKALPNGKVKLNDAYDIPREAMIGLRPDLVLSTTSYGFDEKNGFATRDQLKEVGAH
FT                   TYVSPQGCDQDTSKMTVADSYTLLRDMGKIFNVRDRAEQLIAASEKHIAEISAKVKGEK
FT                   QPKVMVLFSNMAMGGNDFSSVVAKGIYNDILAKAGGSNAFASASKTSFADLSKEKVAAT
FT                   DVDALVVIGYNDPNPAAYAKKLLKEFPQWPAAKNNTYVALSDSMYLGPSNDLAVEKIAK
FT                   ALHPDKF"
     MSKKRPVAVA LAGALCLVTA ACADSSTDQD GATGDKASAA AAKSGYPAIL ENCGVSEKFT        60
     KAPGRVVVMN GASVAEVSTL LSLGLGDRVV ANQQSYGMSE VPGRAKAIKA LPNGKVKLND       120
     AYDIPREAMI GLRPDLVLST TSYGFDEKNG FATRDQLKEV GAHTYVSPQG CDQDTSKMTV       180
     ADSYTLLRDM GKIFNVRDRA EQLIAASEKH IAEISAKVKG EKQPKVMVLF SNMAMGGNDF       240
     SSVVAKGIYN DILAKAGGSN AFASASKTSF ADLSKEKVAA TDVDALVVIG YNDPNPAAYA       300
     KKLLKEFPQW PAAKNNTYVA LSDSMYLGPS NDLAVEKIAK ALHPDKF                     347
//

If you have problems or comments...

PBIL Back to PBIL home page