(data stored in ACNUC7421 zone)

EMBL: BA000030.FECD1

BA000030.FECD1       Location/Qualifiers
FT   CDS             complement(752205..753176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD1"
FT                   /locus_tag="SAVERM_601"
FT                   /old_locus_tag="SAV_601"
FT                   /product="putative ABC transporter iron(III)/siderophore
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_601"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68311"
FT                   /db_xref="GOA:Q79ZS3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q79ZS3"
FT                   /protein_id="BAC68311.1"
FT                   /translation="MVAVSIGAVNIPVADVWGILLHHVTGRGAAGDPALDQIVWTFRAP
FT                   RVALAALVGAGLAVAGAVLQTLVSNPLADPVVLGFSYGASLGAVLVITLGGVALGGLAG
FT                   LGVSGAAFVGALAAGALVFALGQRQGRLAPTRLVLAGVAVGYVLLSVTSFVQLLATPTE
FT                   LRTVMFWMLGSVAGAQWSQLPTVTAVVLTSTVVLTLFGRRLNALLAGDESATALGVDVN
FT                   RLRAVLLVISALLTGTVIAVAGGVGFVGLMIPHLVRLTTGADHRRLLPLTALLGAVYLV
FT                   LVDLLSRTVNRPNELPLGILTALLGAPFFLWLLRRDKGLDTV"
     MVAVSIGAVN IPVADVWGIL LHHVTGRGAA GDPALDQIVW TFRAPRVALA ALVGAGLAVA        60
     GAVLQTLVSN PLADPVVLGF SYGASLGAVL VITLGGVALG GLAGLGVSGA AFVGALAAGA       120
     LVFALGQRQG RLAPTRLVLA GVAVGYVLLS VTSFVQLLAT PTELRTVMFW MLGSVAGAQW       180
     SQLPTVTAVV LTSTVVLTLF GRRLNALLAG DESATALGVD VNRLRAVLLV ISALLTGTVI       240
     AVAGGVGFVG LMIPHLVRLT TGADHRRLLP LTALLGAVYL VLVDLLSRTV NRPNELPLGI       300
     LTALLGAPFF LWLLRRDKGL DTV                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page