(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPF1

BA000030.GVPF1       Location/Qualifiers
FT   CDS             complement(749194..749916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpF1"
FT                   /locus_tag="SAVERM_597"
FT                   /old_locus_tag="SAV_597"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_597"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68307"
FT                   /db_xref="GOA:Q82QB3"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB3"
FT                   /protein_id="BAC68307.1"
FT                   /translation="MAVYVYAITAASHPLRLDGVTGVGEPPEKLRTVNSRSLAAVVSDA
FT                   PDGLRAKRRDVLAHEAVLERLMAEGSVLPLRFGAVTSDDQAVLQVLDERAASYQERLTA
FT                   LDGCVEFHLKASCDEDALLREILLQSPEAHQLNEQIRSGRAGPDLQIALGERVAGEVQL
FT                   RHESFAAGAVEALRPLARDIRASDPKGGDFVSVSFLVDKARQEGFTAAEQDLANERGAD
FT                   FDFRLHGPLPPYSFVEAT"
     MAVYVYAITA ASHPLRLDGV TGVGEPPEKL RTVNSRSLAA VVSDAPDGLR AKRRDVLAHE        60
     AVLERLMAEG SVLPLRFGAV TSDDQAVLQV LDERAASYQE RLTALDGCVE FHLKASCDED       120
     ALLREILLQS PEAHQLNEQI RSGRAGPDLQ IALGERVAGE VQLRHESFAA GAVEALRPLA       180
     RDIRASDPKG GDFVSVSFLV DKARQEGFTA AEQDLANERG ADFDFRLHGP LPPYSFVEAT       240
//

If you have problems or comments...

PBIL Back to PBIL home page