(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPG1

BA000030.GVPG1       Location/Qualifiers
FT   CDS             complement(748925..749176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpG1"
FT                   /locus_tag="SAVERM_596"
FT                   /old_locus_tag="SAV_596"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_596"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68306"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB4"
FT                   /protein_id="BAC68306.1"
FT                   /translation="MGLLTHLLTLPLAPVRGVGWVMQQVAQVAEEQYYDPDPVLKELAE
FT                   LERALVSGQIDQETFDRREDELLDRLEEITRFREGTGA"
     MGLLTHLLTL PLAPVRGVGW VMQQVAQVAE EQYYDPDPVL KELAELERAL VSGQIDQETF        60
     DRREDELLDR LEEITRFREG TGA                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page