(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPK1

BA000030.GVPK1       Location/Qualifiers
FT   CDS             complement(746752..747162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpK1"
FT                   /locus_tag="SAVERM_591"
FT                   /old_locus_tag="SAV_591"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_591"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68301"
FT                   /db_xref="GOA:Q82QB9"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB9"
FT                   /protein_id="BAC68301.1"
FT                   /translation="MTPDTPRHQGRSDEAADAAPGPFRLFPAAPQDVPASGNESPPHPA
FT                   SRINTDPDTVERDLIKLVLTLVELIRQLMERQALHRVDAGDLTEEEEERLGMTLMVLHD
FT                   RLNDLCGRYGLTMQDLNIDLGPLGTLLPPSDY"
     MTPDTPRHQG RSDEAADAAP GPFRLFPAAP QDVPASGNES PPHPASRINT DPDTVERDLI        60
     KLVLTLVELI RQLMERQALH RVDAGDLTEE EEERLGMTLM VLHDRLNDLC GRYGLTMQDL       120
     NIDLGPLGTL LPPSDY                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page