(data stored in ACNUC7421 zone)

EMBL: BA000030.GVPL1

BA000030.GVPL1       Location/Qualifiers
FT   CDS             complement(747446..748261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpL1"
FT                   /locus_tag="SAVERM_593"
FT                   /old_locus_tag="SAV_593"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_593"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68303"
FT                   /db_xref="GOA:Q82QB7"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QB7"
FT                   /protein_id="BAC68303.1"
FT                   /translation="MTATVSYLYGVSAVPGGSYDVVAALRGIADAPVRLVPDEDANLAA
FT                   IVSSVPADDFDEAPLAAHLEDLDWLEAVARAHHRVVDAMAARTTVLPLRLATIYRDDDR
FT                   VRAMIRAGHRAFAQRLAHLAGHMEWGVKVYFDPPSAPTASTAAAPAAELSPGRAYLRSR
FT                   HQERDSRQDAYRAAEQAARRVEAAARTQAVEHVRHRLQQGPLSHGSGENIVNNAYLVAD
FT                   GQAEDFRDAVQLAAEQSETIRVEITGPWAPYSFVSRQNEPGEMSEEAIT"
     MTATVSYLYG VSAVPGGSYD VVAALRGIAD APVRLVPDED ANLAAIVSSV PADDFDEAPL        60
     AAHLEDLDWL EAVARAHHRV VDAMAARTTV LPLRLATIYR DDDRVRAMIR AGHRAFAQRL       120
     AHLAGHMEWG VKVYFDPPSA PTASTAAAPA AELSPGRAYL RSRHQERDSR QDAYRAAEQA       180
     ARRVEAAART QAVEHVRHRL QQGPLSHGSG ENIVNNAYLV ADGQAEDFRD AVQLAAEQSE       240
     TIRVEITGPW APYSFVSRQN EPGEMSEEAI T                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page