(data stored in ACNUC7421 zone)

EMBL: BA000030.HSP18_2

BA000030.HSP18_2     Location/Qualifiers
FT   CDS             844710..845141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp18_2"
FT                   /locus_tag="SAVERM_692"
FT                   /old_locus_tag="SAV_692"
FT                   /product="putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_692"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68402"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q82Q29"
FT                   /protein_id="BAC68402.1"
FT                   /translation="MLMRTDPFRELDRLAQHLMGPGTWSRPSAMPMDAYRDGDQYVIAF
FT                   DLPGIDPDALDIDVERNMLTVRAERRPLPRSESAQTELSERPLGVFSRQLVLADTLDTE
FT                   RICADYEAGVLTLRIPIAERAKPRKISVRSTGERQELDG"
     MLMRTDPFRE LDRLAQHLMG PGTWSRPSAM PMDAYRDGDQ YVIAFDLPGI DPDALDIDVE        60
     RNMLTVRAER RPLPRSESAQ TELSERPLGV FSRQLVLADT LDTERICADY EAGVLTLRIP       120
     IAERAKPRKI SVRSTGERQE LDG                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page