(data stored in ACNUC7421 zone)

EMBL: BA000030.MCJB1

BA000030.MCJB1       Location/Qualifiers
FT   CDS             complement(300466..300885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcjB1"
FT                   /locus_tag="SAVERM_7586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_7586"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146F3S8"
FT                   /protein_id="BAU68358.1"
FT                   /translation="MSGQLTLEPSTAIPWNQRPAALVTVTAARLLARVSPRRLRQVLEL
FT                   ASRGARPADLPQALQARNAVVSVSVTIAGPRCLERSIATALLCRLGGTWPQWCTGVTTR
FT                   PFAAHAWVAVDGDAVGEDPDAVTDFHLVMSVPARR"
     MSGQLTLEPS TAIPWNQRPA ALVTVTAARL LARVSPRRLR QVLELASRGA RPADLPQALQ        60
     ARNAVVSVSV TIAGPRCLER SIATALLCRL GGTWPQWCTG VTTRPFAAHA WVAVDGDAVG       120
     EDPDAVTDFH LVMSVPARR                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page