(data stored in ACNUC7421 zone)

EMBL: BA000030.NICT1

BA000030.NICT1       Location/Qualifiers
FT   CDS             709185..710330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nicT1"
FT                   /locus_tag="SAVERM_560"
FT                   /old_locus_tag="SAV_560"
FT                   /product="putative high-affinity nickel-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_560"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68270"
FT                   /db_xref="GOA:Q82QE9"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QE9"
FT                   /protein_id="BAC68270.1"
FT                   /translation="MTAAPTATGGLRSRWRRTSGSMGRAEWGRAAGMAAFIIALHVIGW
FT                   FTLVAIVAPEHYSVGTKGFGIGIGVSAYTLGMRHAFDADHIAAIDNTTRKLMDEGQRPV
FT                   SVGFWFSLGHSSIVFVLALLLSLGVKSLAAPVREDNSELHHVTELIGTTVSGTFLYLIA
FT                   IINIVILAGIWKVFRQMRSGHFDEAALEQQLNNRGLINRLLGRVMKSITKPWQMYPLGL
FT                   LFGLGFDTATEVALLVLAGSGAASGLPWYTILCLPVLFAAGMSLLDTIDGSFMNFAYGW
FT                   AFSKPVRKVYYNLTITGLSVAVALIIGTAELLGLLADKAGLHGVFWDWISGLDLNTIGF
FT                   VIVGLFFATWAAALAVWKLGRIEEKWTAGLRPPEQQADRQR"
     MTAAPTATGG LRSRWRRTSG SMGRAEWGRA AGMAAFIIAL HVIGWFTLVA IVAPEHYSVG        60
     TKGFGIGIGV SAYTLGMRHA FDADHIAAID NTTRKLMDEG QRPVSVGFWF SLGHSSIVFV       120
     LALLLSLGVK SLAAPVREDN SELHHVTELI GTTVSGTFLY LIAIINIVIL AGIWKVFRQM       180
     RSGHFDEAAL EQQLNNRGLI NRLLGRVMKS ITKPWQMYPL GLLFGLGFDT ATEVALLVLA       240
     GSGAASGLPW YTILCLPVLF AAGMSLLDTI DGSFMNFAYG WAFSKPVRKV YYNLTITGLS       300
     VAVALIIGTA ELLGLLADKA GLHGVFWDWI SGLDLNTIGF VIVGLFFATW AAALAVWKLG       360
     RIEEKWTAGL RPPEQQADRQ R                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page