(data stored in ACNUC7421 zone)

EMBL: BA000030.PE108

BA000030.PE108       Location/Qualifiers
FT   CDS             124945..125364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_108"
FT                   /old_locus_tag="SAV_108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_108"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67817"
FT                   /db_xref="GOA:Q82RN5"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN5"
FT                   /protein_id="BAC67817.1"
FT                   /translation="MGFLSPGGPRVLGTVEAVRRQPATLEGFVRRYPTAGDHAGLDGLD
FT                   GDEGGLPALLVVDGRRARSDRPPGQAHGLFGRFLALRTDLGLLAEEYDHVTGWQLGNFP
FT                   QAYSHIGVIGSALLLQQLGSGAPAAEAEVLLAADV"
     MGFLSPGGPR VLGTVEAVRR QPATLEGFVR RYPTAGDHAG LDGLDGDEGG LPALLVVDGR        60
     RARSDRPPGQ AHGLFGRFLA LRTDLGLLAE EYDHVTGWQL GNFPQAYSHI GVIGSALLLQ       120
     QLGSGAPAAE AEVLLAADV                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page