(data stored in ACNUC7421 zone)

EMBL: BA000030.PE113

BA000030.PE113       Location/Qualifiers
FT   CDS             132082..132333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_113"
FT                   /old_locus_tag="SAV_113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_113"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67822"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RN0"
FT                   /protein_id="BAC67822.1"
FT                   /translation="MLRARPGRDEGEREMVHRLASARKAPKVVVERCRTVELSWGGWLV
FT                   PQIADELRCGVGQARTTHPNPQTPLHVHRLRTALIGLH"
     MLRARPGRDE GEREMVHRLA SARKAPKVVV ERCRTVELSW GGWLVPQIAD ELRCGVGQAR        60
     TTHPNPQTPL HVHRLRTALI GLH                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page