(data stored in ACNUC7421 zone)

EMBL: BA000030.PE116

BA000030.PE116       Location/Qualifiers
FT   CDS             133696..134031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_116"
FT                   /old_locus_tag="SAV_116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_116"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67825"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RM7"
FT                   /protein_id="BAC67825.1"
FT                   /translation="MPRRTIRQSRTQQRDNALPGVPRRWRVRRRSVPVVEPPSEPDTHA
FT                   ILSVFTSHVLDMLPWDSQVTFAGVELACRGQVGWVAHRLACVRRAGGCSSPLAGSSPRT
FT                   LSSSLAF"
     MPRRTIRQSR TQQRDNALPG VPRRWRVRRR SVPVVEPPSE PDTHAILSVF TSHVLDMLPW        60
     DSQVTFAGVE LACRGQVGWV AHRLACVRRA GGCSSPLAGS SPRTLSSSLA F                111
//

If you have problems or comments...

PBIL Back to PBIL home page