(data stored in ACNUC7421 zone)

EMBL: BA000030.PE121

BA000030.PE121       Location/Qualifiers
FT   CDS             138932..139393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_121"
FT                   /old_locus_tag="SAV_121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_121"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67830"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RM2"
FT                   /protein_id="BAC67830.1"
FT                   /translation="MFVESGHHWSLRPRAPGFAGERLFQQRVSKSADIRLTAVGDHLTA
FT                   VRIDGSPGIDWRRHYEALTYTPVPVPPEITKGVRAYLDAFGLVFGAFDFGLGTDGRWHW
FT                   YECNPNGQWAWFPDNITAPITNALADRLQHPQGTFQSCCQAALVTGGEV"
     MFVESGHHWS LRPRAPGFAG ERLFQQRVSK SADIRLTAVG DHLTAVRIDG SPGIDWRRHY        60
     EALTYTPVPV PPEITKGVRA YLDAFGLVFG AFDFGLGTDG RWHWYECNPN GQWAWFPDNI       120
     TAPITNALAD RLQHPQGTFQ SCCQAALVTG GEV                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page