(data stored in ACNUC7421 zone)

EMBL: BA000030.PE125

BA000030.PE125       Location/Qualifiers
FT   CDS             142975..143661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_125"
FT                   /old_locus_tag="SAV_125"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_125"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67834"
FT                   /db_xref="GOA:Q82RL8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL8"
FT                   /protein_id="BAC67834.1"
FT                   /translation="MRGPAFMTAPLFAASQLAVNVLSAQSLLAAFGVLGVGVVMFAETG
FT                   LLIGFFLPGDSLLFTAGLLCTGSGQHGVKLSLAPLLVAAAVGALAGAQCGYVLGRKAGG
FT                   ALLARSRSVRLREGAQRAEELLERYGHAKAIVLARFVPVVRTVLNPMAGALGVPARTFT
FT                   VWQVAGGLVWSLGLTLGGYALGSSIPNVDRYLLPIIAVIVAVSLLPLAAELYRSRRAAK
FT                   AKEVRG"
     MRGPAFMTAP LFAASQLAVN VLSAQSLLAA FGVLGVGVVM FAETGLLIGF FLPGDSLLFT        60
     AGLLCTGSGQ HGVKLSLAPL LVAAAVGALA GAQCGYVLGR KAGGALLARS RSVRLREGAQ       120
     RAEELLERYG HAKAIVLARF VPVVRTVLNP MAGALGVPAR TFTVWQVAGG LVWSLGLTLG       180
     GYALGSSIPN VDRYLLPIIA VIVAVSLLPL AAELYRSRRA AKAKEVRG                    228
//

If you have problems or comments...

PBIL Back to PBIL home page