(data stored in ACNUC7421 zone)

EMBL: BA000030.PE127

BA000030.PE127       Location/Qualifiers
FT   CDS             144260..144988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_127"
FT                   /old_locus_tag="SAV_127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_127"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67836"
FT                   /db_xref="GOA:Q82RL6"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL6"
FT                   /protein_id="BAC67836.1"
FT                   /translation="MKRSDLGELAGSVGLGAWTAFGVLTMIVIGDGQPLYGDEDLLSWS
FT                   VGHRPDVPVALARALTATGTGAIPYVLAVLAGTIAGRTLRQRAVATALCLTCLGAGQAA
FT                   RYGVMALVARPRPTRVDWATPASGWAFPSGHTTTAALTAGLLVIAVYTRSPPGRALLAL
FT                   VFGCWGALVGLTRVYLGVHWFTDVVGGWLFAVGWLGLCLCAAAWWLPEAFITGTTDIDQ
FT                   KPPEDHAPQDPGRRGRSRPA"
     MKRSDLGELA GSVGLGAWTA FGVLTMIVIG DGQPLYGDED LLSWSVGHRP DVPVALARAL        60
     TATGTGAIPY VLAVLAGTIA GRTLRQRAVA TALCLTCLGA GQAARYGVMA LVARPRPTRV       120
     DWATPASGWA FPSGHTTTAA LTAGLLVIAV YTRSPPGRAL LALVFGCWGA LVGLTRVYLG       180
     VHWFTDVVGG WLFAVGWLGL CLCAAAWWLP EAFITGTTDI DQKPPEDHAP QDPGRRGRSR       240
     PA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page